PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002127G0260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 30064.1 Da    PI: 9.0227
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002127G0260genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.11.7e-314695150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  PH01002127G0260 46 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 95
                     79***********************************************8 PP

2K-box105.37.4e-351152105100
            K-box   5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      +    ++e +a+++qqe++kL+ +i++Lq+++R+l+G++++++sl++L+qLe +Lek++ kiR++Knell++++e++qk+e elq++n++Lr++
  PH01002127G0260 115 NA-GtVAEVNAQYYQQESSKLRHQINSLQNSNRNLVGDSINTMSLRDLKQLEGRLEKGIAKIRARKNELLYAEVEYMQKREIELQNDNMYLRSR 207
                      23.259999***********************************************************************************99 PP

            K-box  98 lee 100
                      ++e
  PH01002127G0260 208 VAE 210
                      876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006634.1323898IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-423897IPR002100Transcription factor, MADS-box
CDDcd002655.79E-4639112No hitNo description
SuperFamilySSF554554.58E-3339110IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004094IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-334060IPR002100Transcription factor, MADS-box
PfamPF003191.0E-264794IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-336075IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-337596IPR002100Transcription factor, MADS-box
PfamPF014863.0E-26123208IPR002487Transcription factor, K-box
PROSITE profilePS5129714.908124214IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MAFLLMHTGK ADLSCGDSEL KELAAPACSA VAAAAEKMGR GKIEIKRIEN TTNRQVTFCK  60
RRNGLLKKAY ELSVLCDAEV ALIVFSSRGR LYEYANNSVK ATIERYKKAN SDTSNAGTVA  120
EVNAQYYQQE SSKLRHQINS LQNSNRNLVG DSINTMSLRD LKQLEGRLEK GIAKIRARKN  180
ELLYAEVEYM QKREIELQND NMYLRSRVAE NERGQQPMNM MGEASSSEYD HMVPYDSRNF  240
LQVNIMQQQP QHYSHQLQPT ALQLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-2138106169Myocyte-specific enhancer factor 2B
1tqe_R3e-2138106169Myocyte-specific enhancer factor 2B
1tqe_Q3e-2138106169Myocyte-specific enhancer factor 2B
1tqe_P3e-2138106169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0027120.0KJ002712.1 Phyllostachys edulis MADS-box protein 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632498.11e-157PREDICTED: MADS-box transcription factor 3 isoform X2
SwissprotQ407041e-153MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0A8XZ731e-161A0A0A8XZ73_ARUDO; Uncharacterized protein
STRINGLOC_Os01g10504.11e-154(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-105MIKC_MADS family protein